MDB: Melioidosis Database

Protein search results for - W8JYE8

Names and origin

Entry	:	W8JYE8 (unreviewed)
Entry name	:	W8JYE8_BURPE
Protein names	:	50S ribosomal protein L21
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
Gene names	:	rplU
ORF names	:	BBX_831

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L21P family

Protein sequence

Length

111 residues

>W8JYE8|W8JYE8_BURPE Burkholderia pseudomallei MSHR520
MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGEGESIQFGTPLVSGASVK
ATVVSHGRHAKVTIFKMRRRKHYQKHGGHRQNYTELRIDAINA