MDB: Melioidosis Database

Protein search results for - W8JVN6

Names and origin

Entry	:	W8JVN6 (unreviewed)
Entry name	:	W8JVN6_BURPE
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
Gene names	:	rpsJ
ORF names	:	BBX_575

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>W8JVN6|W8JVN6_BURPE Burkholderia pseudomallei MSHR520
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ