MDB: Melioidosis Database

Protein search results for - W8JVJ3

Names and origin

Entry	:	W8JVJ3 (unreviewed)
Entry name	:	W8JVJ3_BURPE
Protein names	:	50S ribosomal protein L31 type B
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
Gene names	:	rpmE
ORF names	:	rpmE2

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein L31P family, Type B subfamily

Protein sequence

Length

95 residues

>W8JVJ3|W8JVJ3_BURPE Burkholderia pseudomallei MSHR520
MKQGIHPDYREVVFQDMSNGFKFITRSTIQTRETIEFEGKTYPLAKIEVSSESHSFYTGQ
QKIMDTAGRVEKFKNKFGARASGKAAK