MDB: Melioidosis Database

Protein search results for - W8JS16

Names and origin

Entry	:	W8JS16 (unreviewed)
Entry name	:	W8JS16_BURPE
Protein names	:	30S ribosomal protein S14
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
Gene names	:	rpsN
ORF names	:	BBX_589

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S14P family

Protein sequence

Length

109 residues

>W8JS16|W8JS16_BURPE Burkholderia pseudomallei MSHR520
MAKLALIEREKKRARLAQKYAPKRAELKAIIDDASKSDEERYAARLELQQLPRNANPTRK
RNRCAITGRPRGTFRKFGLARNKIREIAFRGEIPGLTKASW