MDB: Melioidosis Database

Protein search results for - W8JPZ9

Names and origin

Entry	:	W8JPZ9 (unreviewed)
Entry name	:	W8JPZ9_BURPE
Protein names	:	Rubredoxin
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
ORF names	:	BBX_2910

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	electron carrier activity; iron ion binding; oxidation-reduction process
GO identifier	:	GO:0009055; GO:0005506; GO:0055114

Keywords

Ligand & Biological process

Electron transport; Iron; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to Rubredoxin family

Protein sequence

Length

64 residues

>W8JPZ9|W8JPZ9_BURPE Burkholderia pseudomallei MSHR520
MSEVVEYKSWVCLICGWIYNEAEGLPDEGIAAGTRFADIPHGWRCPLCDVGKEDFVVVEF