MDB: Melioidosis Database

Protein search results for - W8JKQ5

Names and origin

Entry	:	W8JKQ5 (unreviewed)
Entry name	:	W8JKQ5_BURPE
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei MSHR520
Organism ID	:	1249659
Gene names	:	glnB
ORF names	:	BBX_2954

History

Date of creation	:	2014-05-14
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-05-14

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>W8JKQ5|W8JKQ5_BURPE Burkholderia pseudomallei MSHR520
MKRITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEVVVANNLVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTGEENEAAV