MDB: Melioidosis Database

Protein search results for - W0PU77

Names and origin

Entry	:	W0PU77 (unreviewed)
Entry name	:	W0PU77_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei MSHR146
Organism ID	:	1249471
Gene names	:	grxD
ORF names	:	BBN_343

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>W0PU77|W0PU77_BURPE Burkholderia pseudomallei MSHR146
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA