MDB: Melioidosis Database

Protein search results for - W0PST3

Names and origin

Entry	:	W0PST3 (unreviewed)
Entry name	:	W0PST3_BURPE
Protein names	:	50S ribosomal protein L23
Organism	:	Burkholderia pseudomallei MSHR146
Organism ID	:	1249471
Gene names	:	rplW
ORF names	:	BBN_208

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	nucleotide binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0000166; GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L23P family

Protein sequence

Length

112 residues

>W0PST3|W0PST3_BURPE Burkholderia pseudomallei MSHR146
MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQEVKAAVELLFKVEVD
SVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK