MDB: Melioidosis Database

Protein search results for - W0PR92

Names and origin

Entry	:	W0PR92 (unreviewed)
Entry name	:	W0PR92_BURPE
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei MSHR146
Organism ID	:	1249471
Gene names	:	rpsJ
ORF names	:	BBN_205

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>W0PR92|W0PR92_BURPE Burkholderia pseudomallei MSHR146
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ