MDB: Melioidosis Database

Protein search results for - W0ME31

Names and origin

Entry	:	W0ME31 (unreviewed)
Entry name	:	W0ME31_BURPE
Protein names	:	Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
Organism	:	Burkholderia pseudomallei MSHR511
Organism ID	:	1249474
Gene names	:	gatC
ORF names	:	BBQ_3245
EC number	:	6.3.5.-

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ATP binding; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity; regulation of translational fidelity; transferase activity; translation
GO identifier	:	GO:0005524; GO:0050567; GO:0006450; GO:0016740; GO:0006412

Keywords

Ligand & Biological process

ATP-binding; Ligase; Nucleotide-binding; Protein biosynthesis; Transferase

General annotation

Sequence similarities

Belongs to GatC family

Protein sequence

Length

107 residues

>W0ME31|W0ME31_BURPE Burkholderia pseudomallei MSHR511
MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQIL
EVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE