MDB: Melioidosis Database

Protein search results for - W0MBZ6

Names and origin

Entry	:	W0MBZ6 (unreviewed)
Entry name	:	W0MBZ6_BURPE
Protein names	:	Protein CyaY
Organism	:	Burkholderia pseudomallei MSHR511
Organism ID	:	1249474
Gene names	:	cyaY
ORF names	:	BBQ_119

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ferric iron binding; iron-sulfur cluster assembly
GO identifier	:	GO:0008199; GO:0016226

General annotation

Sequence similarities

Belongs to Frataxin family

Protein sequence

Length

116 residues

>W0MBZ6|W0MBZ6_BURPE Burkholderia pseudomallei MSHR511
MSDTDYLTRAEAVLAAVERSVDAANDGDADIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRFVDGAWRDTRSGDEFFAALTGYATQQAGMPIAFSA