MDB: Melioidosis Database

Protein search results for - W0M9S5

Names and origin

Entry	:	W0M9S5 (unreviewed)
Entry name	:	W0M9S5_BURPE
Protein names	:	50S ribosomal protein L22
Organism	:	Burkholderia pseudomallei MSHR511
Organism ID	:	1249474
Gene names	:	rplV
ORF names	:	BBQ_85

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

117 residues

>W0M9S5|W0M9S5_BURPE Burkholderia pseudomallei MSHR511
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN