MDB: Melioidosis Database

Protein search results for - W0M869

Names and origin

Entry	:	W0M869 (unreviewed)
Entry name	:	W0M869_BURPE
Protein names	:	Nitrogen regulatory P-II family protein
Organism	:	Burkholderia pseudomallei MSHR511
Organism ID	:	1249474
ORF names	:	BBQ_2974

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>W0M869|W0M869_BURPE Burkholderia pseudomallei MSHR511
MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRTGETGADAL