MDB: Melioidosis Database

Protein search results for - W0M674

Names and origin

Entry	:	W0M674 (unreviewed)
Entry name	:	W0M674_BURPE
Protein names	:	ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta)
Organism	:	Burkholderia pseudomallei MSHR511
Organism ID	:	1249474
Gene names	:	atpH
ORF names	:	BBQ_3438

History

Date of creation	:	2014-03-19
Date of modification	:	2014-09-03
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier	:	GO:0005886; GO:0042777; GO:0046933; GO:0045261

Keywords

Ligand & Biological process

ATP synthesis; CF(1); Cell membrane; Hydrogen ion transport; Hydrolase; Ion transport; Membrane; Transport

General annotation

Sequence similarities	:	Belongs to ATPase delta chain family
Subcellular location	:	Cell membrane; Peripheral membrane protein.

Protein sequence

Length

191 residues

>W0M674|W0M674_BURPE Burkholderia pseudomallei MSHR511
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAEL
LLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAVQFEALKNAREGAADVQIVSAFPLE
GAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA