MDB: Melioidosis Database

Protein search results for - V9YM04

Names and origin

Entry	:	V9YM04 (unreviewed)
Entry name	:	V9YM04_BURPE
Protein names	:	Protein CyaY
Organism	:	Burkholderia pseudomallei NAU20B-16
Organism ID	:	1249476
Gene names	:	cyaY
ORF names	:	BBS_1725

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ferric iron binding; iron-sulfur cluster assembly
GO identifier	:	GO:0008199; GO:0016226

General annotation

Sequence similarities

Belongs to Frataxin family

Protein sequence

Length

116 residues

>V9YM04|V9YM04_BURPE Burkholderia pseudomallei NAU20B-16
MSDTDYLTRAEAVLAAVERSVDAANDGDADIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRFVDGAWRDTRSGDEFFAALTGYATQQAGMPIAFSA