MDB: Melioidosis Database

Protein search results for - V9Y962

Names and origin

Entry	:	V9Y962 (unreviewed)
Entry name	:	V9Y962_BURPE
Protein names	:	50S ribosomal protein L24
Organism	:	Burkholderia pseudomallei NCTC 13178
Organism ID	:	1249468
Gene names	:	rplX
ORF names	:	BBJ_3045

History

Date of creation	:	2014-03-19
Date of modification	:	2014-07-09
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L24P family

Protein sequence

Length

110 residues

>V9Y962|V9Y962_BURPE Burkholderia pseudomallei NCTC 13178
MNKIRKGDEVIVITGKDKGKRGVVLAVGAEHVTVEGINLVKKHVKPNPMKGTTGGVEAKT
MPLHISNVALVDANGKASRVGIKVEDGKKVRFLKTTGAVLSA