MDB: Melioidosis Database

Protein search results for - V9Y5T0

Names and origin

Entry	:	V9Y5T0 (unreviewed)
Entry name	:	V9Y5T0_BURPE
Protein names	:	Nitrogen regulatory P-II family protein
Organism	:	Burkholderia pseudomallei NCTC 13178
Organism ID	:	1249468
ORF names	:	BBJ_2388

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>V9Y5T0|V9Y5T0_BURPE Burkholderia pseudomallei NCTC 13178
MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRTGETGADAL