MDB: Melioidosis Database

Protein search results for - V9Y5D7

Names and origin

Entry	:	V9Y5D7 (unreviewed)
Entry name	:	V9Y5D7_BURPE
Protein names	:	High-potential iron-sulfur protein (HiPIP)
Organism	:	Burkholderia pseudomallei NCTC 13178
Organism ID	:	1249468
Gene names	:	hip
ORF names	:	BBJ_2590

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	4 iron, 4 sulfur cluster binding; aerobic electron transport chain; electron carrier activity; metal ion binding
GO identifier	:	GO:0051539; GO:0019646; GO:0009055; GO:0046872

Keywords

Ligand & Biological process

4Fe-4S; Electron transport; Iron; Iron-sulfur; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to High-potential iron-sulfur protein (HiPIP) family

Protein sequence

Length

112 residues

>V9Y5D7|V9Y5D7_BURPE Burkholderia pseudomallei NCTC 13178
MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGYKADATKVDKAKFPKY
AAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA