MDB: Melioidosis Database

Protein search results for - V9Y4Q9

Names and origin

Entry	:	V9Y4Q9 (unreviewed)
Entry name	:	V9Y4Q9_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei NCTC 13178
Organism ID	:	1249468
Gene names	:	grxD
ORF names	:	BBJ_3207

History

Date of creation	:	2014-03-19
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-03-19

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>V9Y4Q9|V9Y4Q9_BURPE Burkholderia pseudomallei NCTC 13178
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA