MDB: Melioidosis Database

Protein search results for - U5V239

Names and origin

Entry	:	U5V239 (unreviewed)
Entry name	:	U5V239_BURPE
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
Gene names	:	glnB
ORF names	:	BBK_491

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>U5V239|U5V239_BURPE Burkholderia pseudomallei NCTC 13179
MKRITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEVVVANNLVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTGEENEAAV