MDB: Melioidosis Database

Protein search results for - U5UZN4

Names and origin

Entry	:	U5UZN4 (unreviewed)
Entry name	:	U5UZN4_BURPE
Protein names	:	Rubredoxin
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
ORF names	:	BBK_448

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	electron carrier activity; iron ion binding; oxidation-reduction process
GO identifier	:	GO:0009055; GO:0005506; GO:0055114

Keywords

Ligand & Biological process

Electron transport; Iron; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to Rubredoxin family

Protein sequence

Length

64 residues

>U5UZN4|U5UZN4_BURPE Burkholderia pseudomallei NCTC 13179
MSEVVEYKSWVCLICGWIYNEAEGLPDEGIAAGTRFADIPHGWRCPLCDVGKEDFVVVEF