MDB: Melioidosis Database

Protein search results for - U5UXC2

Names and origin

Entry	:	U5UXC2 (unreviewed)
Entry name	:	U5UXC2_BURPE
Protein names	:	30S ribosomal protein S18
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
Gene names	:	rpsR
ORF names	:	BBK_2957

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S18P family

Protein sequence

Length

99 residues

>U5UXC2|U5UXC2_BURPE Burkholderia pseudomallei NCTC 13179
MARPTGKKFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLT
GTKAHYQRQLDTAIKRARFLALLPYTDQHKA