MDB: Melioidosis Database

Protein search results for - U5UVI8

Names and origin

Entry	:	U5UVI8 (unreviewed)
Entry name	:	U5UVI8_BURPE
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
Gene names	:	rpsJ
ORF names	:	BBK_1660

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>U5UVI8|U5UVI8_BURPE Burkholderia pseudomallei NCTC 13179
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ