MDB: Melioidosis Database

Protein search results for - U5UU89

Names and origin

Entry	:	U5UU89 (unreviewed)
Entry name	:	U5UU89_BURPE
Protein names	:	30S ribosomal protein S19
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
Gene names	:	rpsS
ORF names	:	BBK_1665

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; small ribosomal subunit; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0015935; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S19P family

Protein sequence

Length

99 residues

>U5UU89|U5UU89_BURPE Burkholderia pseudomallei NCTC 13179
MARSVKKGPFCDAHLLKKVEAAAASRDKKPIKTWSRRSTILPDFIGLTIAVHNGRQHVPV
YISENMVGHKLGEFALTRTFKGHAADKKAKK