MDB: Melioidosis Database

Protein search results for - U5USH8

Names and origin

Entry	:	U5USH8 (unreviewed)
Entry name	:	U5USH8_BURPE
Protein names	:	RNA-binding protein Hfq
Organism	:	Burkholderia pseudomallei NCTC 13179
Organism ID	:	1241583
Gene names	:	hfq
ORF names	:	BBK_3015

History

Date of creation	:	2014-01-22
Date of modification	:	2014-06-11
Date of sequence modification	:	2014-01-22

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	RNA binding; regulation of transcription, DNA-templated; response to stress
GO identifier	:	GO:0003723; GO:0006355; GO:0006950

Keywords

Ligand & Biological process

RNA-binding; Stress response

General annotation

Sequence similarities

Belongs to Hfq family

Protein sequence

Length

87 residues

>U5USH8|U5USH8_BURPE Burkholderia pseudomallei NCTC 13179
MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI
STVVPARPVNFHPDAEAAS