MDB: Melioidosis Database

Protein search results for - Q3JXC2

Names and origin

Entry	:	Q3JXC2 (reviewed)
Entry name	:	GATC_BURP1
Protein names	:	Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
Gene names	:	gatC
ORF names	:	BURPS1710b_0367
EC number	:	6.3.5.-

History

Date of creation	:	2008-01-15
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ATP binding; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity; regulation of translational fidelity; translation
GO identifier	:	GO:0005524; GO:0050567; GO:0006450; GO:0006412

Keywords

Ligand & Biological process

ATP-binding; Complete proteome; Ligase; Nucleotide-binding; Protein biosynthesis

General annotation

Sequence similarities

Belongs to GatC family

Protein sequence

Length

107 residues

>Q3JXC2|GATC_BURP1 Burkholderia pseudomallei 1710b
MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQIL
EVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE