MDB: Melioidosis Database

Protein search results for - Q3JX54

Names and origin

Entry	:	Q3JX54 (unreviewed)
Entry name	:	Q3JX54_BURP1
Protein names	:	High-potential iron-sulfur protein (HiPIP)
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
Gene names	:	hpiS
ORF names	:	BURPS1710b_0435

History

Date of creation	:	2005-11-08
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	4 iron, 4 sulfur cluster binding; aerobic electron transport chain; electron carrier activity; metal ion binding
GO identifier	:	GO:0051539; GO:0019646; GO:0009055; GO:0046872

Keywords

Ligand & Biological process

4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to High-potential iron-sulfur protein (HiPIP) family

Protein sequence

Length

112 residues

>Q3JX54|Q3JX54_BURP1 Burkholderia pseudomallei 1710b
MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGYKADATKVDKAKFPKY
AAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA