MDB: Melioidosis Database

Protein search results for - Q3JUU9

Names and origin

Entry	:	Q3JUU9 (unreviewed)
Entry name	:	Q3JUU9_BURP1
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
ORF names	:	BURPS1710b_1243

History

Date of creation	:	2005-11-08
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>Q3JUU9|Q3JUU9_BURP1 Burkholderia pseudomallei 1710b
MKRITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEVVVANNLVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTGEENEAAV