MDB: Melioidosis Database

Protein search results for - Q3JNF9

Names and origin

Entry	:	Q3JNF9 (reviewed)
Entry name	:	RL27_BURP1
Protein names	:	50S ribosomal protein L27
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
Gene names	:	rpmA
ORF names	:	BURPS1710b_3523

History

Date of creation	:	2008-01-15
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein L27P family

Protein sequence

Length

95 residues

>Q3JNF9|RL27_BURP1 Burkholderia pseudomallei 1710b
MAHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRMHAGENVGMGKDHTLF
ALVDGHVKFTTKGAAKKHTVVVVPAAA