MDB: Melioidosis Database

Protein search results for - Q3JMR8

Names and origin

Entry	:	Q3JMR8 (reviewed)
Entry name	:	RL22_BURP1
Protein names	:	50S ribosomal protein L22
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
Gene names	:	rplV
ORF names	:	BURPS1710b_3771

History

Date of creation	:	2006-06-27
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

117 residues

>Q3JMR8|RL22_BURP1 Burkholderia pseudomallei 1710b
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN