MDB: Melioidosis Database

Protein search results for - Q3JMR5

Names and origin

Entry	:	Q3JMR5 (reviewed)
Entry name	:	RL23_BURP1
Protein names	:	50S ribosomal protein L23
Organism	:	Burkholderia pseudomallei 1710b
Organism ID	:	320372
Gene names	:	rplW
ORF names	:	BURPS1710b_3774

History

Date of creation	:	2007-01-23
Date of modification	:	2014-05-14
Date of sequence modification	:	2005-11-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	nucleotide binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0000166; GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L23P family

Protein sequence

Length

112 residues

>Q3JMR5|RL23_BURP1 Burkholderia pseudomallei 1710b
MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQEVKAAVELLFKVEVD
SVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK