MDB: Melioidosis Database

Protein search results for - C0YAV2

Names and origin

Entry	:	C0YAV2 (unreviewed)
Entry name	:	C0YAV2_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei Pakistan 9
Organism ID	:	595498
ORF names	:	BUH_3681

History

Date of creation	:	2009-05-26
Date of modification	:	2014-04-16
Date of sequence modification	:	2009-05-26

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>C0YAV2|C0YAV2_BURPE Burkholderia pseudomallei Pakistan 9
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA