MDB: Melioidosis Database

Protein search results for - C0YAD7

Names and origin

Entry	:	C0YAD7 (unreviewed)
Entry name	:	C0YAD7_BURPE
Protein names	:	50S ribosomal protein L22
Organism	:	Burkholderia pseudomallei Pakistan 9
Organism ID	:	595498
Gene names	:	rplV
ORF names	:	BUH_3848

History

Date of creation	:	2009-05-26
Date of modification	:	2014-03-19
Date of sequence modification	:	2009-05-26

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

117 residues

>C0YAD7|C0YAD7_BURPE Burkholderia pseudomallei Pakistan 9
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN