MDB: Melioidosis Database

Protein search results for - C0YAD1

Names and origin

Entry	:	C0YAD1 (unreviewed)
Entry name	:	C0YAD1_BURPE
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei Pakistan 9
Organism ID	:	595498
Gene names	:	rpsJ
ORF names	:	BUH_3854

History

Date of creation	:	2009-05-26
Date of modification	:	2014-03-19
Date of sequence modification	:	2009-05-26

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>C0YAD1|C0YAD1_BURPE Burkholderia pseudomallei Pakistan 9
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ