MDB: Melioidosis Database

Protein search results for - B7CY13

Names and origin

Entry	:	B7CY13 (unreviewed)
Entry name	:	B7CY13_BURPE
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei 576
Organism ID	:	557724
Gene names	:	rpsJ
ORF names	:	BUC_4045

History

Date of creation	:	2009-02-10
Date of modification	:	2014-03-19
Date of sequence modification	:	2009-02-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>B7CY13|B7CY13_BURPE Burkholderia pseudomallei 576
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ