MDB: Melioidosis Database

Protein search results for - B7CXX2

Names and origin

Entry	:	B7CXX2 (unreviewed)
Entry name	:	B7CXX2_BURPE
Protein names	:	Protein CyaY
Organism	:	Burkholderia pseudomallei 576
Organism ID	:	557724
Gene names	:	cyaY
ORF names	:	BUC_4004

History

Date of creation	:	2009-02-10
Date of modification	:	2014-03-19
Date of sequence modification	:	2009-02-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ferric iron binding; iron-sulfur cluster assembly
GO identifier	:	GO:0008199; GO:0016226

General annotation

Sequence similarities

Belongs to Frataxin family

Protein sequence

Length

116 residues

>B7CXX2|B7CXX2_BURPE Burkholderia pseudomallei 576
MSDTDYLTRAEAVLAAVERSVDAANDGDADIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAAKAGGFHYRFVDGAWRDTRSGDEFFAALTGYATQQAGMPIAFSA