MDB: Melioidosis Database

Protein search results for - B7CXK1

Names and origin

Entry	:	B7CXK1 (unreviewed)
Entry name	:	B7CXK1_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei 576
Organism ID	:	557724
Gene names	:	grxD
ORF names	:	BUC_3881

History

Date of creation	:	2009-02-10
Date of modification	:	2014-04-16
Date of sequence modification	:	2009-02-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>B7CXK1|B7CXK1_BURPE Burkholderia pseudomallei 576
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA