MDB: Melioidosis Database

Protein search results for - B7CTZ3

Names and origin

Entry	:	B7CTZ3 (unreviewed)
Entry name	:	B7CTZ3_BURPE
Protein names	:	50S ribosomal protein L20
Organism	:	Burkholderia pseudomallei 576
Organism ID	:	557724
Gene names	:	rplT
ORF names	:	BUC_2420

History

Date of creation	:	2009-02-10
Date of modification	:	2014-03-19
Date of sequence modification	:	2009-02-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L20P family

Protein sequence

Length

127 residues

>B7CTZ3|B7CTZ3_BURPE Burkholderia pseudomallei 576
MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL
WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVKQVKAAVAA