MDB: Melioidosis Database

Protein search results for - B2H3A3

Names and origin

Entry	:	B2H3A3 (unreviewed)
Entry name	:	B2H3A3_BURPE
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei 1655
Organism ID	:	331109
Gene names	:	glnB
ORF names	:	BURPS1655_K0258

History

Date of creation	:	2008-06-10
Date of modification	:	2014-04-16
Date of sequence modification	:	2008-06-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>B2H3A3|B2H3A3_BURPE Burkholderia pseudomallei 1655
MKRITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEVVVANNLVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTGEENEAAV