MDB: Melioidosis Database

Protein search results for - B2H009

Names and origin

Entry	:	B2H009 (unreviewed)
Entry name	:	B2H009_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei 1655
Organism ID	:	331109
ORF names	:	BURPS1655_E0194

History

Date of creation	:	2008-06-10
Date of modification	:	2014-04-16
Date of sequence modification	:	2008-06-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>B2H009|B2H009_BURPE Burkholderia pseudomallei 1655
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA