MDB: Melioidosis Database

Protein search results for - B2GZL5

Names and origin

Entry	:	B2GZL5 (unreviewed)
Entry name	:	B2GZL5_BURPE
Protein names	:	50S ribosomal protein L24
Organism	:	Burkholderia pseudomallei 1655
Organism ID	:	331109
Gene names	:	rplX
ORF names	:	BURPS1655_E0048

History

Date of creation	:	2008-06-10
Date of modification	:	2014-02-19
Date of sequence modification	:	2008-06-10

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L24P family

Protein sequence

Length

110 residues

>B2GZL5|B2GZL5_BURPE Burkholderia pseudomallei 1655
MNKIRKGDEVIVITGKDKGKRGVVLAVGAEHVTVEGINLVKKHVKPNPMKGTTGGVEAKT
MPLHISNVALVDANGKASRVGIKVEDGKKVRFLKTTGAVLSA