MDB: Melioidosis Database

Protein search results for - B1HLG1

Names and origin

Entry	:	B1HLG1 (unreviewed)
Entry name	:	B1HLG1_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei S13
Organism ID	:	320374
ORF names	:	BURPSS13_S0176

History

Date of creation	:	2008-04-29
Date of modification	:	2014-04-16
Date of sequence modification	:	2008-04-29

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>B1HLG1|B1HLG1_BURPE Burkholderia pseudomallei S13
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA