MDB: Melioidosis Database

Protein search results for - B1HJT2

Names and origin

Entry	:	B1HJT2 (unreviewed)
Entry name	:	B1HJT2_BURPE
Protein names	:	30S ribosomal protein S18
Organism	:	Burkholderia pseudomallei S13
Organism ID	:	320374
Gene names	:	rpsR
ORF names	:	BURPSS13_P0906

History

Date of creation	:	2008-04-29
Date of modification	:	2014-02-19
Date of sequence modification	:	2008-04-29

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S18P family

Protein sequence

Length

99 residues

>B1HJT2|B1HJT2_BURPE Burkholderia pseudomallei S13
MARPTGKKFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLT
GTKAHYQRQLDTAIKRARFLALLPYTDQHKA