MDB: Melioidosis Database

Protein search results for - B1HEN8

Names and origin

Entry	:	B1HEN8 (unreviewed)
Entry name	:	B1HEN8_BURPE
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei S13
Organism ID	:	320374
Gene names	:	glnB
ORF names	:	BURPSS13_I0057

History

Date of creation	:	2008-04-29
Date of modification	:	2014-04-16
Date of sequence modification	:	2008-04-29

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>B1HEN8|B1HEN8_BURPE Burkholderia pseudomallei S13
MKRITAIIKPFKLDEVREALAEVGLTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEVVVANNLVDQVIDAVIGAARTGKIGDGKIFVSDVERVIRIRTGEENEAAV