MDB: Melioidosis Database

Protein search results for - A8KSM3

Names and origin

Entry	:	A8KSM3 (unreviewed)
Entry name	:	A8KSM3_BURPE
Protein names	:	50S ribosomal protein L22
Organism	:	Burkholderia pseudomallei Pasteur 52237
Organism ID	:	331978
Gene names	:	rplV
ORF names	:	BURPSPAST_P0149

History

Date of creation	:	2007-12-04
Date of modification	:	2014-02-19
Date of sequence modification	:	2007-12-04

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

117 residues

>A8KSM3|A8KSM3_BURPE Burkholderia pseudomallei Pasteur 52237
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN