MDB: Melioidosis Database

Protein search results for - A8KP54

Names and origin

Entry	:	A8KP54 (unreviewed)
Entry name	:	A8KP54_BURPE
Protein names	:	RNA-binding protein Hfq
Organism	:	Burkholderia pseudomallei Pasteur 52237
Organism ID	:	331978
Gene names	:	hfq
ORF names	:	BURPSPAST_AA0907

History

Date of creation	:	2007-12-04
Date of modification	:	2014-02-19
Date of sequence modification	:	2007-12-04

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	RNA binding; regulation of transcription, DNA-templated; response to stress
GO identifier	:	GO:0003723; GO:0006355; GO:0006950

Keywords

Ligand & Biological process

RNA-binding; Stress response

General annotation

Sequence similarities

Belongs to Hfq family

Protein sequence

Length

87 residues

>A8KP54|A8KP54_BURPE Burkholderia pseudomallei Pasteur 52237
MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI
STVVPARPVNFHPDAEAAS