MDB: Melioidosis Database

Protein search results for - A8EMH7

Names and origin

Entry	:	A8EMH7 (unreviewed)
Entry name	:	A8EMH7_BURPE
Protein names	:	Glutaredoxin
Organism	:	Burkholderia pseudomallei 406e
Organism ID	:	360118
ORF names	:	BURPS406E_I0638

History

Date of creation	:	2007-11-13
Date of modification	:	2014-04-16
Date of sequence modification	:	2007-11-13

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

110 residues

>A8EMH7|A8EMH7_BURPE Burkholderia pseudomallei 406e
MDTQQRIKQIVDENPVVLFMKGTAQFPMCGFSGRAVQVLKACGVDQFKTVNVLEDEEIRQ
GIKEFSNWPTIPQLYVKGEFVGGSDIMMEMYQSGELQQLFTA