MDB: Melioidosis Database

Protein search results for - A8EM39

Names and origin

Entry	:	A8EM39 (unreviewed)
Entry name	:	A8EM39_BURPE
Protein names	:	30S ribosomal protein S17
Organism	:	Burkholderia pseudomallei 406e
Organism ID	:	360118
Gene names	:	rpsQ
ORF names	:	BURPS406E_I0495

History

Date of creation	:	2007-11-13
Date of modification	:	2014-02-19
Date of sequence modification	:	2007-11-13

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein S17P family

Protein sequence

Length

98 residues

>A8EM39|A8EM39_BURPE Burkholderia pseudomallei 406e
MNDSVKTSLKRTLVGKVVSNKMDKTVTVLVEHRVKHPIYGKYVVRSKKYHAHDEANTYNE
GDLVEIQETRPVSKTKAWAVSRLVEAARVI