MDB: Melioidosis Database

Protein search results for - A8EHJ2

Names and origin

Entry	:	A8EHJ2 (unreviewed)
Entry name	:	A8EHJ2_BURPE
Protein names	:	Rubredoxin
Organism	:	Burkholderia pseudomallei 406e
Organism ID	:	360118
ORF names	:	BURPS406E_K0154

History

Date of creation	:	2007-11-13
Date of modification	:	2014-06-11
Date of sequence modification	:	2007-11-13

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	electron carrier activity; iron ion binding; oxidation-reduction process
GO identifier	:	GO:0009055; GO:0005506; GO:0055114

Keywords

Ligand & Biological process

Electron transport; Iron; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to Rubredoxin family

Protein sequence

Length

60 residues

>A8EHJ2|A8EHJ2_BURPE Burkholderia pseudomallei 406e
MEYKSWMCLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECGARKEDFEMVQI