MDB: Melioidosis Database

Protein search results for - A8E906

Names and origin

Entry	:	A8E906 (unreviewed)
Entry name	:	A8E906_BURPE
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei 406e
Organism ID	:	360118
Gene names	:	glnB
ORF names	:	BURPS406E_B0780

History

Date of creation	:	2007-11-13
Date of modification	:	2014-09-03
Date of sequence modification	:	2007-11-13

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>A8E906|A8E906_BURPE Burkholderia pseudomallei 406e
MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRTGETGADAL